| Edit |   |
|---|
| Antigenic Specificity | LINGO-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LINGO-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LINGO-4. This antibody reacts with human. The LINGO-4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LINGO4(leucine rich repeat and Ig domain containing 4) The peptide sequence was selected from the middle region of LINGO4. Peptide sequence TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT. |
|---|
| Other Names | leucine rich repeat and Ig domain containing 4, leucine rich repeat neuronal 6D, PRO34002 |
|---|
| Gene, Accession # | LINGO4, Gene ID: 339398 |
|---|
| Catalog # | NBP1-70601 |
|---|
| Price | |
|---|
| Order / More Info | LINGO-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|