| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LINGO-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LINGO-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LINGO-1. This antibody reacts with human. The LINGO-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LINGO-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV |
|---|
| Other Names | FLJ14594, LERN1UNQ201, leucine rich repeat and Ig domain containing 1, leucine rich repeat neuronal 6A, Leucine-rich repeat and immunoglobilin domain-containing protein 1, Leucine-rich repeat neuronal protein 1, Leucine-rich repeat neuronal protein 6A, LRRN6Aleucine-rich repeat neuronal 6A, MGC17422 |
|---|
| Gene, Accession # | LINGO1, Gene ID: 84894 |
|---|
| Catalog # | NBP2-57689 |
|---|
| Price | |
|---|
| Order / More Info | LINGO-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|