| Edit |   |
|---|
| Antigenic Specificity | LINC00521 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LINC00521 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LINC00521. This antibody reacts with human. The LINC00521 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human C14orf48The immunogen for this antibody is C14orf48. Peptide sequence MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL. |
|---|
| Other Names | c14_5713, C14orf48, chromosome 14 open reading frame 48, DKFZp434O1910, MGC33356 |
|---|
| Gene, Accession # | LINC00521, Gene ID: 256369 |
|---|
| Catalog # | NBP1-79594-20ul |
|---|
| Price | |
|---|
| Order / More Info | LINC00521 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|