| Edit |   |
|---|
| Antigenic Specificity | Corneodesmosin |
|---|
| Clone | 6F11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Corneodesmosin Antibody (6F11) from Novus Biologicals is a mouse monoclonal antibody to Corneodesmosin. This antibody reacts with human. The Corneodesmosin Antibody (6F11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CDSN (NP_001255 306 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP |
|---|
| Other Names | corneodesmosin, D6S586E, differentiated keratinocyte S protein, HTSS, S, S protein |
|---|
| Gene, Accession # | CDSN, Gene ID: 1041, Accession: NP_001255, SwissProt: NP_001255 |
|---|
| Catalog # | H00001041-M01 |
|---|
| Price | |
|---|
| Order / More Info | Corneodesmosin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24506732, 26071937, 27193164 |
|---|