| Edit |   |
|---|
| Antigenic Specificity | C2orf27B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C2orf27B Antibody from Novus Biologicals is a rabbit polyclonal antibody to C2orf27B. This antibody reacts with human. The C2orf27B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MGC50273(MGC50273 protein) The peptide sequence was selected from the N terminal of MGC50273. Peptide sequence MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE. |
|---|
| Other Names | chromosome 2 open reading frame 27B, hypothetical protein LOC408029, MGC50273 |
|---|
| Gene, Accession # | C2ORF27B, Gene ID: 408029, Accession: Q580R0-2, SwissProt: Q580R0-2 |
|---|
| Catalog # | NBP1-56812-20ul |
|---|
| Price | |
|---|
| Order / More Info | C2orf27B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|