| Edit |   |
|---|
| Antigenic Specificity | DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation. |
|---|
| Immunogen | DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH |
|---|
| Other Names | DDX34|HRH1|1200013B07Rik|1810012L18Rik|Ddx34|mKIAA0134 |
|---|
| Gene, Accession # | Gene ID: 9704 |
|---|
| Catalog # | ABIN633572 |
|---|
| Price | |
|---|
| Order / More Info | DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|