产品详情 |
Edit |   |
Antigenic Specificity | DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined. |
Immunogen | DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR |
Other Names | DDX32|DHLP1|3110079L04Rik|4732469F02Rik|AA408140|Ddx32 |
Gene, Accession # | Gene ID: 55760 |
Catalog # | ABIN633369 |
Price | |
Order / More Info | DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |
产品资料 |
|
|