| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRAIL/TNFSF10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAIL/TNFSF10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAIL/TNFSF10. This antibody reacts with human. The TRAIL/TNFSF10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRAIL/TNFSF10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS |
|---|
| Other Names | Apo-2 ligand, APO2L, Apo-2Ltumor necrosis factor (ligand) family, member 10, APO2Ltumor necrosis factor apoptosis-inducing ligand splice variant delta, CD253, CD253 antigen, Protein TRAIL, TL2, TNF-related apoptosis-inducing ligand, TRAILTNF-related apoptosis inducing ligand TRAIL, tumor necrosis factor (ligand) superfamily, member 10, tumor necrosis factor ligand superfamily member 10 |
|---|
| Gene, Accession # | TNFSF10, Gene ID: 8743, Accession: P50591, SwissProt: P50591 |
|---|
| Catalog # | NBP2-38744 |
|---|
| Price | |
|---|
| Order / More Info | TRAIL/TNFSF10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|