| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SNRP70 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNRP70 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNRP70. This antibody reacts with human, mouse. The SNRP70 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)) The peptide sequence was selected from the N terminal of SNRP70 (NP_003080). Peptide sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYS |
|---|
| Other Names | RNPU1ZU170K, RPU1U1AP, small nuclear ribonucleoprotein 70kDa (U1), Snp1, snRNP70, SNRP70U1 small nuclear ribonucleoprotein 70 kDa, U1 snRNP 70 kDa, U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen), U1AP1, U1RNP |
|---|
| Gene, Accession # | SNRNP70, Gene ID: 6625, Accession: P08621, SwissProt: P08621 |
|---|
| Catalog # | NBP1-57487 |
|---|
| Price | |
|---|
| Order / More Info | SNRP70 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 15146197, 23389473 |
|---|
| 产品资料 |
|
|