| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SNRP70 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNRP70 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNRP70. This antibody reacts with human. The SNRP70 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SNRP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQ |
|---|
| Other Names | RNPU1ZU170K, RPU1U1AP, small nuclear ribonucleoprotein 70kDa (U1), Snp1, snRNP70, SNRP70U1 small nuclear ribonucleoprotein 70 kDa, U1 snRNP 70 kDa, U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen), U1AP1, U1RNP |
|---|
| Gene, Accession # | SNRNP70, Gene ID: 6625, Accession: P08621, SwissProt: P08621 |
|---|
| Catalog # | NBP2-37896 |
|---|
| Price | |
|---|
| Order / More Info | SNRP70 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|