| 产品详情 |
| Edit |   |
| Antigenic Specificity | SNRNP48 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SNRNP48 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNRNP48. This antibody reacts with human. The SNRNP48 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SNRNP48 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIP |
| Other Names | C6orf151, chromosome 6 open reading frame 151, dJ336K20B.1, dJ512B11.2, FLJ32234, MGC138904, MGC138905, small nuclear ribonucleoprotein 48kDa (U11/U12), U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11/U12 snRNP 48 kDa protein, U11/U12 snRNP 48K, U11/U12-48K |
| Gene, Accession # | SNRNP48, Gene ID: 154007 |
| Catalog # | NBP1-86760 |
| Price | |
| Order / More Info | SNRNP48 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|