| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SNRNP27 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNRNP27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNRNP27. This antibody reacts with human. The SNRNP27 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SNRNP27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNR |
|---|
| Other Names | Nucleic acid-binding protein RY-1, putative nucleic acid binding protein RY-1, RY1,27K, small nuclear ribonucleoprotein 27kDa (U4/U6.U5), U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein, U4/U6.U5 snRNP 27 kDa protein, U4/U6.U5 tri-snRNP-associated 27 kDa protein, U4/U6.U5 tri-snRNP-associated protein 3, U4/U6.U5-27K |
|---|
| Gene, Accession # | SNRNP27, Gene ID: 11017 |
|---|
| Catalog # | NBP1-80808 |
|---|
| Price | |
|---|
| Order / More Info | SNRNP27 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|