| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CMTM5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CMTM5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CMTM5. This antibody reacts with human. The CMTM5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CMTM5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI |
|---|
| Other Names | chemokine-like factor super family 5, chemokine-like factor superfamily 5, Chemokine-like factor superfamily member 5, CKLF-like MARVEL transmembrane domain containing 5, CKLF-like MARVEL transmembrane domain-containing protein 5, CKLFSF5, FLJ37521 |
|---|
| Gene, Accession # | CMTM5, Gene ID: 116173 |
|---|
| Catalog # | NBP2-47503 |
|---|
| Price | |
|---|
| Order / More Info | CMTM5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|