| 产品详情 |
| Edit |   |
| Antigenic Specificity | CMTM4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 29180877). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CMTM4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CMTM4. This antibody reacts with human. The CMTM4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CMTM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ |
| Other Names | chemokine-like factor super family 4, chemokine-like factor superfamily 4, Chemokine-like factor superfamily member 4, CKLF-like MARVEL transmembrane domain containing 4, CKLF-like MARVEL transmembrane domain-containing protein 4, CKLFSF4 |
| Gene, Accession # | CMTM4, Gene ID: 146223 |
| Catalog # | NBP1-84457 |
| Price | |
| Order / More Info | CMTM4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29180877 |
| 产品资料 |
|
|