| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HCAP-G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HCAP-G Antibody from Novus Biologicals is a rabbit polyclonal antibody to HCAP-G. This antibody reacts with human. The HCAP-G Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HCAP-G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETLTPEIALYWCALCEYLKSKGDEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDT |
|---|
| Other Names | CAP-G, CAPGHCAP-G, CHCG, chromosome condensation protein G, Chromosome-associated protein G, condensin complex subunit 3, Condensin subunit CAP-G, FLJ12450, hCAP-G, Melanoma antigen NY-MEL-3, MGC126525, Non-SMC condensin I complex subunit G, non-SMC condensin I complex, subunit G, NYMEL3, NY-MEL-3, XCAP-G homolog |
|---|
| Gene, Accession # | NCAPG, Gene ID: 64151 |
|---|
| Catalog # | NBP1-88199 |
|---|
| Price | |
|---|
| Order / More Info | HCAP-G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|