| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDE8A |
|---|
| Clone | 1H6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDE8A Antibody (1H6) from Novus Biologicals is a mouse monoclonal antibody to PDE8A. This antibody reacts with human. The PDE8A Antibody (1H6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PDE8A (NP_002596.1, 32 a.a. - 121 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL |
|---|
| Other Names | cAMP-specific cyclic nucleotide phosphodiesterase 8A, EC 3.1.4.17, FLJ16150, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A, high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A, HsT19550, phosphodiesterase 8A |
|---|
| Gene, Accession # | PDE8A, Gene ID: 5151, Accession: NP_002596, SwissProt: NP_002596 |
|---|
| Catalog # | H00005151-M02 |
|---|
| Price | |
|---|
| Order / More Info | PDE8A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|