| Edit |   |
| Antigenic Specificity | OCEL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The OCEL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OCEL1. This antibody reacts with human. The OCEL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human OCEL1The immunogen for this antibody is OCEL1. Peptide sequence VWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFDDQGDSEGSVYF. |
| Other Names | FLJ22709, FWP009, occludin/ELL domain containing 1, occludin/ELL domain-containing protein 1, S863-9 |
| Gene, Accession # | OCEL1, Gene ID: 79629, Accession: NP_078854, SwissProt: NP_078854 |
| Catalog # | NBP1-79396-20ul |
| Price | |
| Order / More Info | OCEL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |