| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FCP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FCP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FCP1. This antibody reacts with human. The FCP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FCP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HPVVMKGLCAECGQDLTQLQSKNGKQQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRNRKLVLMVDLDQTLIHTTEQHCQQMSNK |
|---|
| Other Names | CCFDN, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, CTD of POLR2A, phosphatase of, subunit 1, EC 3.1.3.16, FCP1TFIIF-associating CTD phosphatase 1, RNA polymerase II subunit A C-terminal domain phosphatase, serine phosphatase FCP1a, subunit 1, TFIIF-associating CTD phosphatase, transcription factor IIF-associating CTD phosphatase 1 |
|---|
| Gene, Accession # | CTDP1, Gene ID: 9150 |
|---|
| Catalog # | NBP1-84704 |
|---|
| Price | |
|---|
| Order / More Info | FCP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|