| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TFIIS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TFIIS Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFIIS. This antibody reacts with human. The TFIIS Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TFIIS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVG |
|---|
| Other Names | Testis-specific S-II, TFIIS, transcription elongation factor A (SII), 2, transcription elongation factor A protein 2, Transcription elongation factor S-II protein 2, transcription elongation factor TFIIS.1, Transcription elongation factor TFIIS.l |
|---|
| Gene, Accession # | TCEA2, Gene ID: 6919 |
|---|
| Catalog # | NBP2-13418 |
|---|
| Price | |
|---|
| Order / More Info | TFIIS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|