| 产品详情 |
| Edit |   |
| Antigenic Specificity | TFIIE beta |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 26996949). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TFIIE beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFIIE beta. This antibody reacts with human, mouse, rat. The TFIIE beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat TFIIE beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL |
| Other Names | FE, General transcription factor IIE subunit 2, general transcription factor IIE, polypeptide 2 (beta subunit, 34kD), general transcription factor IIE, polypeptide 2, beta 34kDa, TF2E2TFIIE-beta, TFIIE-B, transcription initiation factor IIE subunit beta |
| Gene, Accession # | GTF2E2, Gene ID: 2961 |
| Catalog # | NBP1-87931 |
| Price | |
| Order / More Info | TFIIE beta Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26996949 |
| 产品资料 |
|
|