| Edit |   |
|---|
| Antigenic Specificity | TFIIB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TFIIB Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFIIB. This antibody reacts with rat. The TFIIB Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence GAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRT. |
|---|
| Other Names | general transcription factor IIB, General transcription factor TFIIB, S300-II, TFIIBTF2BRNA polymerase II transcription factor IIB, transcription initiation factor IIB |
|---|
| Gene, Accession # | GTF2B, Gene ID: 2959, Accession: NP_112303 |
|---|
| Catalog # | NBP1-91492 |
|---|
| Price | |
|---|
| Order / More Info | TFIIB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|