| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Neuroplastin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neuroplastin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuroplastin. This antibody reacts with human. The Neuroplastin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Neuroplastin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFV |
|---|
| Other Names | GP55Stromal cell-derived receptor 1, GP65SDR-1, MGC102805, neuroplastin, np55, np65, SDFR1DKFZp686L2477, SDR1stromal cell derived factor receptor 1 |
|---|
| Gene, Accession # | NPTN, Gene ID: 27020 |
|---|
| Catalog # | NBP2-56293 |
|---|
| Price | |
|---|
| Order / More Info | Neuroplastin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|