| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Neuropilin-2 |
|---|
| Clone | 3B8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neuropilin-2 Antibody (3B8) from Novus Biologicals is a mouse monoclonal antibody to Neuropilin-2. This antibody reacts with human. The Neuropilin-2 Antibody (3B8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | NRP2 (NP_958436 621 a.a. - 715 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC |
|---|
| Other Names | MGC126574, neuropilin 2, neuropilin-2, neuropilin-2a(22), neuropilin-2b(0), NP2, NPN 2, NPN2, PRO2714, receptor for VEGF165 and semaphorins class3, Vascular endothelial cell growth factor 165 receptor 2, vascular endothelial growth factor-165 receptor 2, VEGF1265R2, VEGF165R2neuropilin-2a(17) |
|---|
| Gene, Accession # | NRP2, Gene ID: 8828, Accession: NP_958436, SwissProt: NP_958436 |
|---|
| Catalog # | H00008828-M01 |
|---|
| Price | |
|---|
| Order / More Info | Neuropilin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|