| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Neuropilin-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 26199980). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neuropilin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuropilin-2. This antibody reacts with human. The Neuropilin-2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Neuropilin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL |
|---|
| Other Names | MGC126574, neuropilin 2, neuropilin-2, neuropilin-2a(22), neuropilin-2b(0), NP2, NPN 2, NPN2, PRO2714, receptor for VEGF165 and semaphorins class3, Vascular endothelial cell growth factor 165 receptor 2, vascular endothelial growth factor-165 receptor 2, VEGF1265R2, VEGF165R2neuropilin-2a(17) |
|---|
| Gene, Accession # | NRP2, Gene ID: 8828, Accession: O60462, SwissProt: O60462 |
|---|
| Catalog # | NBP1-86866 |
|---|
| Price | |
|---|
| Order / More Info | Neuropilin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26199980 |
|---|
| 产品资料 |
|
|