| Edit |   |
| Antigenic Specificity | CALML3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CALML3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CALML3. This antibody reacts with human. The CALML3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is CALML3. Peptide sequence TVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTR. |
| Other Names | calmodulin-like 3, calmodulin-like protein 3, CaM-like protein, CLPCalmodulin-related protein NB-1 |
| Gene, Accession # | CALML3, Gene ID: 810, Accession: NP_005176, SwissProt: NP_005176 |
| Catalog # | NBP1-79929 |
| Price | |
| Order / More Info | CALML3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |