| Edit |   |
|---|
| Antigenic Specificity | CALML3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CALML3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CALML3. This antibody reacts with human. The CALML3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is CALML3. Peptide sequence TVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTR. |
|---|
| Other Names | calmodulin-like 3, calmodulin-like protein 3, CaM-like protein, CLPCalmodulin-related protein NB-1 |
|---|
| Gene, Accession # | CALML3, Gene ID: 810, Accession: NP_005176, SwissProt: NP_005176 |
|---|
| Catalog # | NBP1-79929-20ul |
|---|
| Price | |
|---|
| Order / More Info | CALML3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|