| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARID2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARID2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARID2. This antibody reacts with human. The ARID2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ARID2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDITQQDTAKGD |
|---|
| Other Names | ARID domain-containing protein 2, AT rich interactive domain 2 (ARID, RFX-like), BAF200KIAA1557AT-rich interactive domain-containing protein 2, BRG1-associated factor 200, DKFZp686G052, DKFZp779P0222, FLJ30619, p200, Zinc finger protein with activation potential, zipzap, zipzap/p200 |
|---|
| Gene, Accession # | ARID2, Gene ID: 196528 |
|---|
| Catalog # | NBP2-57220 |
|---|
| Price | |
|---|
| Order / More Info | ARID2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|