| Edit |   |
|---|
| Antigenic Specificity | ARHGEF19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARHGEF19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARHGEF19. This antibody reacts with human. The ARHGEF19 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ARHGEF19 (Rho guanine nucleotide exchange factor (GEF) 19) The peptide sequence was selected from the middle region of ARHGEF19 (NP_694945). Peptide sequence: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS. |
|---|
| Other Names | ephexin-2, FLJ33962, Rho guanine nucleotide exchange factor (GEF) 19, RP4-733M16.1, weakly similar to Rho GEF, WGEFrho guanine nucleotide exchange factor 19 |
|---|
| Gene, Accession # | ARHGEF19, Gene ID: 128272, Accession: Q8IW93, SwissProt: Q8IW93 |
|---|
| Catalog # | NBP1-57038 |
|---|
| Price | |
|---|
| Order / More Info | ARHGEF19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|