| Edit |   |
|---|
| Antigenic Specificity | ALG1L3P |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALG1L3P Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG1L3P. This antibody reacts with human. The ALG1L3P Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC650515(similar to beta-1,4-mannosyltransferase) The peptide sequence was selected from the C terminal of LOC650515. Peptide sequence VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI. |
|---|
| Other Names | asparagine-linked glycosylation 1-like 3, pseudogene, LOC650515 |
|---|
| Gene, Accession # | ALG1L3P, Gene ID: 100132066 |
|---|
| Catalog # | NBP1-70615 |
|---|
| Price | |
|---|
| Order / More Info | ALG1L3P Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|