| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALG9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALG9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG9. This antibody reacts with human. The ALG9 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ALG9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNL |
|---|
| Other Names | alpha-1,2-mannosyltransferase ALG9, asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha-1,2-mannosyltransferase), asparagine-linked glycosylation 9 homolog (yeast, alpha 1,2mannosyltransferase), asparagine-linked glycosylation 9 homolog (yeast, alpha-1,2-mannosyltransferase), asparagine-linked glycosylation 9, alpha- 1,2-mannosyltransferase homolog (S.cerevisiae, alpha- 1,2-mannosyltransferase), asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 9 homolog, CDG1L, DIBD1FLJ21845, disrupted in bipolar affective disorder 1, Disrupted in bipolar disorder protein 1, DKFZp586M2420, EC 2.4.1.-, LOH11CR1J, loss of heterozygosity, 11, chromosomal region 1 gene J product |
|---|
| Gene, Accession # | ALG9, Gene ID: 79796 |
|---|
| Catalog # | NBP1-90191 |
|---|
| Price | |
|---|
| Order / More Info | ALG9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|