| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALG8 |
|---|
| Clone | 2E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALG8 Antibody (2E10) from Novus Biologicals is a mouse monoclonal antibody to ALG8. This antibody reacts with human. The ALG8 Antibody (2E10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ALG8 (NP_076984, 260 a.a. 335 a.a) partial recombinant protein with GST tag.NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGL KLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP |
|---|
| Other Names | alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 8 homolog (S. cerevisiae, asparagine-linked glycosylation 8 homolog (yeast, asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 8 homolog, CDG1H, dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase, dolichyl-P-glucose:Glc1Man9GlcNAc2-PP-dolichyl-alpha-1,3-glucosyltransferase, EC 2.4.1, EC 2.4.1.-, HUSSY-02, MGC2840, probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase |
|---|
| Gene, Accession # | ALG8, Gene ID: 79053, Accession: NP_076984, SwissProt: NP_076984 |
|---|
| Catalog # | H00079053-M01 |
|---|
| Price | |
|---|
| Order / More Info | ALG8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|