| 产品详情 |
| Edit |   |
| Antigenic Specificity | ALG6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALG6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG6. This antibody reacts with human. The ALG6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ALG6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI |
| Other Names | alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 6 homolog (S. cerevisiae, asparagine-linked glycosylation 6 homolog (yeast, asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 6 homolog, CDG1C, dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase, dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase, EC 2.4.1, EC 2.4.1.-, Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase |
| Gene, Accession # | ALG6, Gene ID: 29929 |
| Catalog # | NBP2-56400 |
| Price | |
| Order / More Info | ALG6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|