| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALG3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALG3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG3. This antibody reacts with human. The ALG3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ALG3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR |
|---|
| Other Names | alpha-1,3-mannosyltransferase), asparagine-linked glycosylation 3 homolog (S. cerevisiae, asparagine-linked glycosylation 3 homolog (yeast, asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 3 homolog, carbohydrate deficient glycoprotein syndrome type IV, CDGS4D16Ertd36e, Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase, dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase, dol-P-Man dependent alpha(1-3)-mannosyltransferase, Dol-P-Man-dependent alpha(1-3)-mannosyltransferase, EC 2.4.1.130, NOT, Not56, NOT56LCDG1D, Not56-like protein |
|---|
| Gene, Accession # | ALG3, Gene ID: 10195, Accession: Q92685, SwissProt: Q92685 |
|---|
| Catalog # | NBP1-91658 |
|---|
| Price | |
|---|
| Order / More Info | ALG3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|