| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARIH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARIH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARIH2. This antibody reacts with human. The ARIH2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ARIH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLV |
|---|
| Other Names | ARI-2, ariadne (Drosophila) homolog 2, ariadne homolog 2 (Drosophila), E3 ubiquitin-protein ligase ARIH2, EC 6.3.2.-, FLJ10938, FLJ33921, Protein ariadne-2 homolog, Triad1 protein, TRIAD1ARI2all-trans retinoic acid inducible RING finger |
|---|
| Gene, Accession # | ARIH2, Gene ID: 10425 |
|---|
| Catalog # | NBP2-57762 |
|---|
| Price | |
|---|
| Order / More Info | ARIH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|