| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARIH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARIH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARIH1. This antibody reacts with human. The ARIH1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ARIH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN |
|---|
| Other Names | ARI-1, ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1(Drosophila), ariadne, Drosophila, homolog of, ARIMOP-6, FLJ20329, FLJ93118, H7-AP2, HARI, Monocyte protein 6, MOP6, protein ariadne-1 homolog, UbcH7-binding protein, UBCH7BPariadne (Drosophila) homolog, ubiquitin-conjugating enzyme E2-binding protein1,HHARIDKFZp686O13120, UbcM4-interacting protein, Ubiquitin-conjugating enzyme E2-binding protein 1 |
|---|
| Gene, Accession # | ARIH1, Gene ID: 25820 |
|---|
| Catalog # | NBP2-57888 |
|---|
| Price | |
|---|
| Order / More Info | ARIH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|