| Edit |   |
|---|
| Antigenic Specificity | ARID3C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARID3C Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARID3C. This antibody reacts with human. The ARID3C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human ARID3CThe immunogen for this antibody is ARID3C (NP_001017363). Peptide Sequence: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING |
|---|
| Other Names | ARID domain-containing protein 3C, AT rich interactive domain 3C (BRIGHT- like), AT rich interactive domain 3C (BRIGHT-like), AT-rich interactive domain-containing protein 3C |
|---|
| Gene, Accession # | ARID3C, Gene ID: 138715, Accession: A6NKF2, SwissProt: A6NKF2 |
|---|
| Catalog # | NBP1-79363-20ul |
|---|
| Price | |
|---|
| Order / More Info | ARID3C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|