| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MKK7/MEK7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MKK7/MEK7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MKK7/MEK7. This antibody reacts with human. The MKK7/MEK7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MKK7/MEK7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK |
|---|
| Other Names | c-Jun N-terminal kinase kinase 2, dual specificity mitogen-activated protein kinase kinase 7, EC 2.7.12.2, JNK kinase 2, JNK-activating kinase 2, JNKK 2, JNKK2, MAP kinase kinase 7, MAPK/ERK kinase 7, MAPKK7, MEK 7, MEK7, mitogen-activated protein kinase kinase 7, MKK7MAPKK 7, PRKMK7 |
|---|
| Gene, Accession # | MAP2K7, Gene ID: 5609 |
|---|
| Catalog # | NBP2-56278 |
|---|
| Price | |
|---|
| Order / More Info | MKK7/MEK7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|