| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MKK6/MEK6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MKK6/MEK6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MKK6/MEK6. This antibody reacts with human, mouse, rat. The MKK6/MEK6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat MKK6/MEK6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR |
|---|
| Other Names | MAP kinase kinase 6, MAPK/ERK kinase 6, MAPKK6dual specificity mitogen-activated protein kinase kinase 6, MEK6MAPKK 6, mitogen-activated protein kinase kinase 6, MKK6MEK 6, PRKMK6protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6), SAPKK3EC 2.7.12.2 |
|---|
| Gene, Accession # | MAP2K6, Gene ID: 5608 |
|---|
| Catalog # | NBP1-87791 |
|---|
| Price | |
|---|
| Order / More Info | MKK6/MEK6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|