| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CLEC3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CLEC3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLEC3A. This antibody reacts with human. The CLEC3A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CLEC3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR |
|---|
| Other Names | Cartilage-derived C-type lectin, CLECSF1, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived), C-type lectin domain family 3 member A, C-type lectin domain family 3, member A, C-type lectin superfamily member 1, C-type lectin, superfamily member 1, MGC129558, MGC129559 |
|---|
| Gene, Accession # | CLEC3A, Gene ID: 10143, Accession: O75596, SwissProt: O75596 |
|---|
| Catalog # | NBP2-30595 |
|---|
| Price | |
|---|
| Order / More Info | CLEC3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|