| 产品详情 |
| Edit |   |
| Antigenic Specificity | CLEC14A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CLEC14A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLEC14A. This antibody reacts with human. The CLEC14A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CLEC14A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKL |
| Other Names | C14orf27, CEG1, chromosome 14 open reading frame 27, ClECT and EGF-like domain containing protein, C-type lectin domain family 14 member A, C-type lectin domain family 14, member A, EGFR5, EGFR-5, Epidermal growth factor receptor 5 |
| Gene, Accession # | CLEC14A, Gene ID: 161198, Accession: Q86T13, SwissProt: Q86T13 |
| Catalog # | NBP2-30854 |
| Price | |
| Order / More Info | CLEC14A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28912033 |
| 产品资料 |
|
|