| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HADH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HADH Antibody from Novus Biologicals is a rabbit polyclonal antibody to HADH. This antibody reacts with human. The HADH Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human HADH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIV |
|---|
| Other Names | EC 1.1.1, EC 1.1.1.35, HADH1, HADHSChydroxyacyl-Coenzyme A dehydrogenase, HCDH, hydroxyacyl-CoA dehydrogenase, L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain, Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase, MGC8392, mitochondrial, MSCHAD, SCHADHHF4 |
|---|
| Gene, Accession # | HADH, Gene ID: 3033 |
|---|
| Catalog # | NBP2-55402 |
|---|
| Price | |
|---|
| Order / More Info | HADH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|