| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HABP1/C1QBP/GC1q R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HABP1/C1QBP/GC1q R Antibody from Novus Biologicals is a rabbit polyclonal antibody to HABP1/C1QBP/GC1q R. This antibody reacts with human, mouse, rat. The HABP1/C1QBP/GC1q R Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat HABP1/C1QBP/GC1q R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY |
|---|
| Other Names | C1q globular domain-binding protein, C1qBP, complement component 1 Q subcomponent-binding protein, mitochondrial, complement component 1, q subcomponent binding protein, GC1QBP, gC1qR, gC1Q-R, GC1q-R protein, Glycoprotein gC1qBP, HABP1p33, Hyaluronan-binding protein 1, Mitochondrial matrix protein p32, p32, SF2P32, splicing factor SF2-associated protein |
|---|
| Gene, Accession # | C1QBP, Gene ID: 708 |
|---|
| Catalog # | NBP1-89790 |
|---|
| Price | |
|---|
| Order / More Info | HABP1/C1QBP/GC1q R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24874554 |
|---|
| 产品资料 |
|
|