| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HABP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HABP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HABP4. This antibody reacts with human. The HABP4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HABP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPE |
|---|
| Other Names | chromodomain helicase DNA binding protein 3 interacting protein, hyaluronan binding protein 4, IHABP-4, IHABP4MGC825, intracellular antigen detected by monoclonal Ki-1, intracellular hyaluronan-binding protein 4, Ki-1/57, Ki-1/57 intracellular antigen, SERBP1L |
|---|
| Gene, Accession # | HABP4, Gene ID: 22927, Accession: Q5JVS0, SwissProt: Q5JVS0 |
|---|
| Catalog # | NBP2-30907 |
|---|
| Price | |
|---|
| Order / More Info | HABP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|