| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CLNS1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CLNS1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLNS1A. This antibody reacts with human. The CLNS1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CLNS1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEE |
|---|
| Other Names | chloride channel regulatory protein, Chloride channel, nucleotide sensitive 1A, chloride channel, nucleotide-sensitive, 1A, Chloride conductance regulatory protein ICln, Chloride ion current inducer protein, ClCI, CLNS1B, I(Cln), ICln, methylosome subunit pICln, Reticulocyte pICln, reticulocyte protein ICln |
|---|
| Gene, Accession # | CLNS1A, Gene ID: 1207, Accession: P54105, SwissProt: P54105 |
|---|
| Catalog # | NBP2-33964 |
|---|
| Price | |
|---|
| Order / More Info | CLNS1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|