| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CL-K1/COLEC11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CL-K1/COLEC11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CL-K1/COLEC11. This antibody reacts with human. The CL-K1/COLEC11 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CL-K1/COLEC11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM |
|---|
| Other Names | CLK1, CL-K1, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, collectin kidney I, Collectin kidney protein 1, collectin sub-family member 11, collectin-11, DKFZp686N1868, MGC3279 |
|---|
| Gene, Accession # | COLEC11, Gene ID: 78989, Accession: Q9BWP8 |
|---|
| Catalog # | NBP1-81120 |
|---|
| Price | |
|---|
| Order / More Info | CL-K1/COLEC11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|