| Edit |   |
| Antigenic Specificity | SFT2D3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SFT2D3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SFT2D3. This antibody reacts with human. The SFT2D3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human SFT2D3. Peptide sequence EYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAE. |
| Other Names | MGC5391, SFT2 domain containing 3, SFT2 domain-containing protein 3, vesicle transport protein SFT2C |
| Gene, Accession # | SFT2D3, Gene ID: 84826, Accession: NP_116129, SwissProt: NP_116129 |
| Catalog # | NBP1-91511 |
| Price | |
| Order / More Info | SFT2D3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |