| Edit |   |
|---|
| Antigenic Specificity | Wnt-6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Wnt-6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Wnt-6. This antibody reacts with human. The Wnt-6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WNT6(wingless-type MMTV integration site family, member 6) The peptide sequence was selected from the middle region of WNT6. Peptide sequence ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG. |
|---|
| Other Names | protein Wnt-6, wingless-type MMTV integration site family, member 6 |
|---|
| Gene, Accession # | WNT6, Gene ID: 7475, Accession: Q9Y6F9, SwissProt: Q9Y6F9 |
|---|
| Catalog # | NBP1-62305 |
|---|
| Price | |
|---|
| Order / More Info | Wnt-6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|