| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IDH3B |
|---|
| Clone | 3A10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG3 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IDH3B Antibody (3A10) from Novus Biologicals is a mouse monoclonal antibody to IDH3B. This antibody reacts with human. The IDH3B Antibody (3A10) has been validated for the following applications: ELISA. |
|---|
| Immunogen | IDH3B (NP_008830 296 a.a. - 384 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG |
|---|
| Other Names | EC 1.1.1, EC 1.1.1.41, FLJ11043, H-IDHB, isocitrate dehydrogenase [NAD] subunit beta, mitochondrial, isocitrate dehydrogenase 3 (NAD+) beta, isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit, Isocitric dehydrogenase subunit beta, MGC903, NAD(+)-specific ICDH subunit beta, NAD+-specific ICDH, NAD+-specific isocitrate dehydrogenase b subunit, NAD+-specific isocitrate dehydrogenase beta, RP46 |
|---|
| Gene, Accession # | IDH3B, Gene ID: 3420, Accession: NP_008830, SwissProt: NP_008830 |
|---|
| Catalog # | H00003420-M01 |
|---|
| Price | |
|---|
| Order / More Info | IDH3B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|