| Edit |   |
| Antigenic Specificity | TMEM93 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM93 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM93. This antibody reacts with human. The TMEM93 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM93(transmembrane protein 93) The peptide sequence was selected from the N terminal of TMEM93. Peptide sequence AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG. |
| Other Names | MGC2963, transmembrane protein 93 |
| Gene, Accession # | EMC6, Gene ID: 83460, Accession: Q9BV81, SwissProt: Q9BV81 |
| Catalog # | NBP1-59735 |
| Price | |
| Order / More Info | TMEM93 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |