| Edit |   |
| Antigenic Specificity | TMEM9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM9. This antibody reacts with human. The TMEM9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM9(transmembrane protein 9) The peptide sequence was selected from the C terminal of TMEM9. Peptide sequence DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS. |
| Other Names | Dermal papilla-derived protein 4, DERP4, TMEM9A, transmembrane protein 9 |
| Gene, Accession # | TMEM9, Gene ID: 252839, Accession: Q9P0T7, SwissProt: Q9P0T7 |
| Catalog # | NBP1-69589 |
| Price | |
| Order / More Info | TMEM9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |